Total number of results for Ornithorhynchus anatinus are 2
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02700 |
FPNQHLCGSHLVEALYLVCGEKGFYYIPRM
|
30 | Ornithorhynchus anatinus | Insulin | Insulin B chain | 8868070#Nourse A., Treacy G.B., Shaw D.C., Jeffrey P.D.#Platypus insulin: indications from the amino acid sequence of significant differences in structure from porcine insulin.# Biol. Chem. Hoppe-Seyler 377:147-153(1996). | |
| NP02701 |
GIVEECCKGVCSMYQLENYCN
|
21 | Ornithorhynchus anatinus | Insulin | Insulin A chain | 8868070#Nourse A., Treacy G.B., Shaw D.C., Jeffrey P.D.#Platypus insulin: indications from the amino acid sequence of significant differences in structure from porcine insulin.# Biol. Chem. Hoppe-Seyler 377:147-153(1996). |